PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011074319.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 381aa    MW: 43724.5 Da    PI: 6.6636
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011074319.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093093432155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++e+  LA+++gL+++q+ +WF N+R ++
  XP_011074319.1 309 KWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 343
                     669*****************************885 PP

2ELK361.6e-12263284122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK++Ll+KYsgyL+sLkqE+s
  XP_011074319.1 263 ELKNHLLKKYSGYLSSLKQELS 284
                     9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.4E-23120164IPR005540KNOX1
PfamPF037908.3E-24121163IPR005540KNOX1
SMARTSM012563.0E-30171222IPR005541KNOX2
PfamPF037913.8E-25176221IPR005541KNOX2
PROSITE profilePS5121311.243263283IPR005539ELK domain
SMARTSM011881.0E-6263284IPR005539ELK domain
PfamPF037897.5E-10263284IPR005539ELK domain
PROSITE profilePS5007112.957283346IPR001356Homeobox domain
SuperFamilySSF466891.45E-19284358IPR009057Homeodomain-like
SMARTSM003892.8E-13285350IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-27288349IPR009057Homeodomain-like
CDDcd000861.18E-11295347No hitNo description
PfamPF059201.1E-16303342IPR008422Homeobox KN domain
PROSITE patternPS000270321344IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MEEYNNHHHQ LSENASSRGS GFPYAGPVLA PSSSVYARTS SGSSNHHGQL PMNSFHLQSG  60
DCYDQSQGQQ HHPVVKTEAG SSQNHNSPRF YYYQNVQDHH HHHSHDHRRQ ESDQAPGEVD  120
AIKAKIIAHP QYSNLLEAYM DCQKVGAPPE VVARLTAVRQ EFEARQRATV ASRDDSKDPE  180
LDQFMEAYCD MLVKYREELT RPLQEAMEFM RRIETQLNML TSDPVRIFNS EKCEGVGSSE  240
DDQDNSGGET ALPEIDPRAE DRELKNHLLK KYSGYLSSLK QELSKKKKKG KLPKDARQKL  300
LSWWELHYKW PYPSESEKVA LAESTGLDQK QINNWFINQR KRHWKPSEDM QFMVMDGLHP  360
QSAALYMEGH YMGEGPYRLG P
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.10.0PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-179KN1_SOLLC; Homeotic protein knotted-1
TrEMBLA0A061FMA10.0A0A061FMA1_THECC; KNOTTED-like from
STRINGVIT_18s0001g08380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-137KNOTTED-like from Arabidopsis thaliana